SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039635 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039635
Domain Number 1 Region: 850-928
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 161-252
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 251-301
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 305-359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 5 Region: 54-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000255
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039635   Gene: ENSBTAG00000010241   Transcript: ENSBTAT00000039849
Sequence length 953
Comment pep:known chromosome:UMD3.1:27:30421577:31075903:1 gene:ENSBTAG00000010241 transcript:ENSBTAT00000039849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAAAAGRGAGGARQWLPWLGLCFWAAGAAAARGTDSGEVLPDSIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDEHIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVPCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTALCPVDGSWEVWSEWSVCSPECEHLRIRECTAPAPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGITLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNPSMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNNRSFTTVHARNKTPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPWAF
QEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWC
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNITDSQLDEADFTYSRQNGL
Download sequence
Identical sequences F1MHX0
NP_001179447.1.59421 NP_001179447.1.76553 ENSBTAP00000039635 ENSBTAP00000039635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]