SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040041 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040041
Domain Number 1 Region: 18-207
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-64
Family Phosphotyrosine-binding domain (PTB) 0.0000000059
Further Details:      
 
Domain Number 2 Region: 361-466
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-28
Family SH2 domain 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040041   Gene: ENSBTAG00000019838   Transcript: ENSBTAT00000040264
Sequence length 473
Comment pep:known chromosome:UMD3.1:3:15671383:15681845:1 gene:ENSBTAG00000019838 transcript:ENSBTAT00000040264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCV
EVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGM
PITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHIL
ECPEGLAQDVISTIGQAFELRFKQYLRNPPRLVTPHDRMAGFDGSAWDEEEEEPPDHQYY
NDFPGKEPPLGGVVDMRLREGALPGAARPTPPSAQTPSHLGATLPVGQPAGGDPEARRQM
PPPPPSSGRELFDDPSYVNVQNLDKARQAGAGAGPPNPTINGSAPRDLFDMKPFEDALRM
PPPPQSTAMAEQLRGEPWFHGKLSRREAEALLQVNGDFLVRESTTTPGQYVLTGLQSGQP
KHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences Q0IIE2
NP_001068773.1.59421 NP_001068773.1.76553 XP_005898724.1.15283 XP_019809853.1.53367 ENSBTAP00000040041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]