SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040892 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040892
Domain Number 1 Region: 10-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.7e-41
Family Multidomain sulfurtransferase (rhodanese) 0.00000776
Further Details:      
 
Domain Number 2 Region: 166-283
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.85e-34
Family Multidomain sulfurtransferase (rhodanese) 0.00000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040892   Gene: ENSBTAG00000030648   Transcript: ENSBTAT00000043315
Sequence length 297
Comment pep:known chromosome:UMD3.1:5:75818030:75827375:1 gene:ENSBTAG00000030648 transcript:ENSBTAT00000043315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKQLFRALVSAQWVAEALRAPQAGQPLRLLDASWYLAKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPSAAHFSEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRVF
GHRTVSLLDGGLRNWLRQGLPLSSGKSRPQPAEFHAVLDPAYIKTYEDIKENLESRRFQV
VDARAAGRFRGTEPEPRDGIEPGHIPGTINIPFTDFLTEDGLEKSPEEIRRLFQDKKVDL
SLPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRAQPEDIISEGRGKIH
Download sequence
Identical sequences Q3MHG3
ENSBTAP00000040892 NP_001231253.1.59421 NP_001231253.1.76553 ENSBTAP00000040892 9913.ENSBTAP00000040892 9913.ENSBTAP00000047128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]