SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041263 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041263
Domain Number 1 Region: 27-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-27
Family Dual specificity phosphatase-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041263   Gene: ENSBTAG00000019496   Transcript: ENSBTAT00000043712
Sequence length 167
Comment pep:known chromosome:UMD3.1:10:67155091:67171864:1 gene:ENSBTAG00000019496 transcript:ENSBTAT00000043712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPSSMQTSEFDSSDEEPIEDEQTPIQISWLPLSRVNCSQFLGLCALPGCKFKDVRRNI
QKDTDGGTPDITSCCEIMEELEICLKNNRKTLIHCYGGLGRSCLVAACLLLYLSDTVSPQ
QAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRNSLSRSVSR
Download sequence
Identical sequences Q32PC4
ENSBTAP00000041263 9913.ENSBTAP00000041263 NP_001035672.1.59421 NP_001035672.1.76553 XP_005968704.1.78601 ENSBTAP00000041263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]