SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043228 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000043228
Domain Number - Region: 170-215
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0667
Family Rad50 coiled-coil Zn hook 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043228   Gene: ENSBTAG00000032340   Transcript: ENSBTAT00000045876
Sequence length 234
Comment pep:known chromosome:UMD3.1:10:36117898:36127741:1 gene:ENSBTAG00000032340 transcript:ENSBTAT00000045876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEDVAHASDCRTTWPPTESAPHLLPPGRRKFPFETQAADAVGGTAVIAEHLLNQSDE
ACGQEQQAPGPQPCRLVTMTSVVKTVYTLQPSCVLSSGLPADAQTRATFKSQLPVKSKEV
DVSRPHSGASENDVTKIIKPRRENGQVKATDTSRRNLRKSYKPLSKQKSEEELKDKNQLL
EAVNKQLHQKLIETQGELKDLTQKVELLEKFQDNCLAILESKGLNPAAVTNFAR
Download sequence
Identical sequences Q2TA15
NP_001033144.1.59421 NP_001033144.1.76553 ENSBTAP00000043228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]