SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044088 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044088
Domain Number 1 Region: 148-215,356-389
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000127
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 2 Region: 236-275,307-390
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000157
Family Calmodulin-like 0.045
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000044088
Domain Number - Region: 10-88
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0464
Family Crotonase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044088   Gene: ENSBTAG00000015943   Transcript: ENSBTAT00000046840
Sequence length 430
Comment pep:known chromosome:UMD3.1:12:35710543:35769962:1 gene:ENSBTAG00000015943 transcript:ENSBTAT00000046840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGGSRLAAWGERLRRGFAAGRRAWPGPGPVAAAVAGVAVAGAGAAWYHGRVNVAAPQ
GSLTVLAQRSVNPGEITGKLSPRKQRFMQFSSLEYGGEYYMTPRDFLFSVMFDHIQRKSS
VKRLTDKDIEDTLAGIKKAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKM
LDADGDEMVEKKEFFKLQKIISKQDDLKTAITDETECQEQTVQEPEINTTLQIRFFGKRG
ERKLHYKEFRRFMENLQAEVQEMEFLQFSKGLSFMRKEDFAEWLLFFTDTENKDVYWKNV
REKLSAGENISLEEFKSFCHFATHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELS
NNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHLGIQEYWKCVKKESIKGVK
EVWKQAGKDL
Download sequence
Identical sequences A4FV38
NP_001076885.1.59421 NP_001076885.1.76553 ENSBTAP00000044088 ENSBTAP00000044088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]