SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045126 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045126
Domain Number 1 Region: 67-191
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-33
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045126   Gene: ENSBTAG00000021064   Transcript: ENSBTAT00000047985
Sequence length 223
Comment pep:novel chromosome:UMD3.1:21:15998170:16090486:1 gene:ENSBTAG00000021064 transcript:ENSBTAT00000047985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCGARRQGTPLLPGRDRALLSSSDNEVEQQDLTQSLGLVKDVISAVDSKVASYEKKVRLN
EIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKSATGRLKEVQAVLLTDILVFL
QEKDQKYVFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGIKDPEMVEVHASSKEERN
SWIQIIQDTINTLNRDEDEGIPSENEEEKKMLDTKARELKGEA
Download sequence
Identical sequences F1N6S0
ENSBTAP00000045126 ENSBTAP00000045126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]