SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045240 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045240
Domain Number 1 Region: 1981-2259
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000125
Further Details:      
 
Domain Number 2 Region: 667-854
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-44
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 3 Region: 856-1051
Classification Level Classification E-value
Superfamily Fibronectin type III 8.51e-40
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 395-445,530-654
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-37
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 1244-1415
Classification Level Classification E-value
Superfamily Fibronectin type III 1.81e-35
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 56-205
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-32
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 1055-1241
Classification Level Classification E-value
Superfamily Fibronectin type III 7.79e-31
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 1427-1615
Classification Level Classification E-value
Superfamily Fibronectin type III 1.65e-30
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 9 Region: 262-394
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-20
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 10 Region: 1631-1731
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000899
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045240   Gene: ENSBTAG00000026977   Transcript: ENSBTAT00000048152
Sequence length 2298
Comment pep:known_by_projection chromosome:UMD3.1:5:10064325:10305992:1 gene:ENSBTAG00000026977 transcript:ENSBTAT00000048152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLIIFLLLFIGTSETQADVSNAVPGTRYEVTISSISATTYSSPVSRTVATNVTKPGPP
VFLAGERVGSAGILLSWNTPPNPNGRIISYIVKYKEVCPWMQATYTQVRTKPDSLEVLLT
NLNPGTTYEIKVAAENSAGIGVFSDPFLFQTAESAPGKVVNLTVEAFNYSAVNLIWYLPR
QPNGKITSFKISVKHARSGIVVKDVSIRVEDILTGKLPECNENNESFLWSTTSPSPTLGR
VTPPPRTTYLSSVLSQSRLALCKEPISLVTHLRPYTTYLFEVSAVTTEAGYIDSTIVRTP
ESVPEGPPQNCLTGNITGRSFAISWDPPTVVTGKFSYRVELYGPSGRILDNSTKDLKFAF
TNLTPFTVYDAYVAAETSAGIGPKSNISVFTPPEAPGAVFDLQVAEVEATEIRITWKKPR
QPNGIINQYRVRVLVSETRVILEDTLLIGKDEVQYINPMAPETVSIVESMAGLFEGSAEM
SSDLYSLASVIYNSHPRNYFPVRGRAEDQPSTFGTSRNQYITDIAAEQLSYVIRRLVPFT
EHMISVSAFTIMGEGPPTVLSVRTLEQVPSSIQVINYKNISSSSILLYWDPPEYPNGKIT
HYTIYAMELDTNRAFQMTTIDNNFLITGLKKYTRYKMRVAASTTVGESSLSEANDIFVRT
PEDEPESSPQDVEVTDVTASEISLKWSPPEKPNGIIVAYEVLYRNVNSLFMKNTSTTNII
LRDLKPYSLYNVSVRSYTRFGHGEQLSSVLSVRTSETVPDSAPENITYRNISSGEIELSF
FPPSSPNGIIQKYTIYLMKSNGNEERTINTTSLVQNIKGLKKYTQYTIEVSASTLKGEGI
RSAPINVLTEEDAPDSPPQDFSVKQLSGVMVKLSWQPPLEPNGIILYYTVYVWDRSSLKT
VNVTETSLEFSDLDHNVEYNAYVTASTRFGDGEKRSNIINFRTPEGAPSDPPKDVQYSNL
SSSSILLFWTPPSKPNGIIQYYSVYYRNTSGTFIQNFTLHEVNDFDNMTVSAIIDKLAIF
SYYTFWVTASTSVGNGNKSSGIVHVYTDQDIPEGVVGNLTYESISSTAVNVSWGPPSQPN
GLVFYYVSLSSQQTPRHVRPPLVTYERSMYFDNLDKYTDYILKVTPSTEKGFSDAYTAQL
HIRTEEDVPETSPIINTFKNLSSTSVLLSWDPPVKPNGAIISYDLTLQGPSENYSFVTSD
NYVILEELSPFTLYSFFAAARTIKGLGPSSVLFFYTDESVPLAPPQNLTLVNYTSDLVWL
KWSPSPVPGGIVKIYSLKIHEHETDTIFYKNISGFQTEAKLVGLEPVSTYSISITAFTKV
GNGNQFSNVVKFTTQESVPDVVQNIQCMATSWQSASVKWDPPKKANGIITHYTITVERNA
TNISPQDHTYTFMKLLANTSYVFEIRASTSAGEGNEMTCNVSTLPETVPSVPMNIAFSNV
QSTSATLTWMRPDSIFGYFQNYKITTQLRAKKCREWDSEDCVEHQKIQYLYEADLTEETV
YGLKKFRWYRFQVAASTNAGYGNASNWISTQTLPGPPDGPPENVHVVATSPFSINISWSE
PTVITGPTFYLIDVKSVDSDEFNISLIKSNEENKTIEVKDLEIFTRYSVVITAFTGNISA
AYVDGKSSAEIIVTTLESVPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIQVYQALV
YREDDPTAVQIHNLSIIQKTDTSVIAMLEGLKGGHTYNISVYAINSAGAGPKVQMRITMD
IKAPARPKTKPTPIYDATGKLLVTSTTITIRMPICYYNDDHGPIKNVQVLVAEAGAQHDG
NVTKWYDAYFNKPRPYFTNEGFPNPPCTEGKAKFSGSEEIYIIGADHACMIPGNEDKICN
GPLKPKKQYLFKFRATNIMGQFTDSDYSDPVKTLSEGLSERTVEIILSVTLCILSIILLG
TAVFAFARIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYRKSIK
PISKKSFLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADLPWNRAKNRFPNIKPYNN
NRVKLIADASIPGSDYINASYVSGYLCPNEFIATQGPLPGTVGDFWRMVWETRAKTLVML
TQCFEKGRIRCHQYWPEDNKPVTVFGDIVITKLMEDVQIDWTIRDLKIERHGDCMTIRQC
NFTAWPEHGVPENSAPLVHFVKLVRASRAHDTTPMIVHCSAGVGRTGVFIALDHLTQHIN
DHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCVLDLLSSKGNNQLICFVNYSALQKMD
SLDAMEGDVELEWEETTM
Download sequence
Identical sequences E1B755
ENSBTAP00000045240 ENSBTAP00000045240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]