SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047885 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047885
Domain Number 1 Region: 37-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 347-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 303-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000391
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047885   Gene: ENSBTAG00000038806   Transcript: ENSBTAT00000054776
Sequence length 420
Comment pep:known_by_projection chromosome:UMD3.1:17:45140914:45151805:-1 gene:ENSBTAG00000038806 transcript:ENSBTAT00000054776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATDLSSIWALPAQDSACFYMRNTKGERIVPGFPATWLQGPMSFKDVAVEFTQEEWMML
DSAQRSMYRDMMLENYINLTLVEYQLCKPVISLSGQEDIRTVKSRIRQGTCPDWEIQFKT
KESTYNQNILGEKSSGGMKIIRFTMDDWSSTLKEDWECGRIRKQHKIPEGILRQVTFTQK
KTTSQERLFDYHELEENSKLRSTLVFSRRVSTSKHCHKCYLNIECLKHNPILNNFENISV
SERLCESHEFDRTLWHLERTQIAQRVYTYCKCDTHFKHNNMLPICNNFLMVENSYECNKN
KIFCHHSSLEQQEQTPTDEKHECNQCGKTFKRISNLILHKGSHMSEKQYECKECGKVFND
SSTLRRHVRTHTGEKPYECNQCGKAFSQKTSLKVHVRTHTGENLMSVIIVENPLAQVLTL
Download sequence
Identical sequences A6QQC1
NP_001098498.1.59421 NP_001098498.1.76553 ENSBTAP00000047885 9913.ENSBTAP00000047885 ENSBTAP00000047885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]