SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048955 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048955
Domain Number 1 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 34-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-16
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 217-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000243
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048955   Gene: ENSBTAG00000001947   Transcript: ENSBTAT00000053384
Sequence length 512
Comment pep:known chromosome:UMD3.1:11:1934700:1943563:-1 gene:ENSBTAG00000001947 transcript:ENSBTAT00000053384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRVSVLPSQDPALPPERGLGEKGTASLFLKARPQDLMTFEDVAVEFTWWEWGQLDPTQ
KDLYWEVMLENFKNLASLGFPVSKPYMICQLEEGEEPCILEREISTGVHSDWERRPQAKK
PMLSQGLSKEELFQRASVEKHIRDEFRSSKLKATCGWDDQVEIYPKKQERHLKETSLTQK
SPPTPKRGHESSESGTSSGLRSVPINQHHVPTGEGYYNCDTEFRQISGRSDSRRTQPGKK
SCKCNECGKLFHFQSELQRHQRRHTGEKPYECGECGRAFGHISSLIKHQRTHTGEKPYEC
SECRRAFSQSSSLVLHYRFHTGEKPYKCNECGRAFGHTSSLIKHQRTHTGEKPYECRECG
RTFSQSSSLIVHYRFHTGEKPYKCNRCGRAFSQSSSLTQHYRHHTGEKPYKCNECGRAFA
HTASLIKHQKSHAGKKTLECNECGKIFGQRTHFAQHQTGHTKQGVGFHHTSSLIKHKRIQ
TSKKLCEYNGFGKALVSGPHIQHQRVYYLKYP
Download sequence
Identical sequences E1B7G1
ENSBTAP00000048955 ENSBTAP00000048955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]