SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048980 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048980
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily POZ domain 7.26e-25
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 575-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000144
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 633-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000744
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048980   Gene: ENSBTAG00000040551   Transcript: ENSBTAT00000051891
Sequence length 713
Comment pep:known_by_projection chromosome:UMD3.1:10:76961607:76979552:1 gene:ENSBTAG00000040551 transcript:ENSBTAT00000051891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHST
AQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDAD
CSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGSEANRWCAEPSSTVNTPHNREPDEESL
QLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDSCGFGFSCEKLLDEHVLTCTN
RHSYQNTRSYHRLVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTG
SRKSSTVESELASEEKSRAAERKRIIIKMEPEDIPTDELKDFNIIKVTDKDCNESTDNDE
LEDEAEEPFYRYYVEEDVSIKKSGRKTLKPRMSINADERGGLENMRPPNNSSPVQEDTEN
ASCELCGLTITEEDLSSHYLAKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNG
LGNAEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSIQKKQLFKHSACPFRCPNCG
QRFETENLVVEHMSSCLDQDVFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVH
TKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAG
ETICQVCFQIFPNNEQLEQHMDIHLYTCGICGAKFNLRKDMRSHYNAKHLKRT
Download sequence
Identical sequences F1MAZ0 L8IEJ8 W5NSA0
ENSOARP00000001040 ENSBTAP00000048980 ENSBTAP00000048980 NP_001179930.1.59421 NP_001179930.1.76553 XP_005212037.1.76553 XP_005898309.1.15283 XP_006072209.1.26621 XP_006072210.1.26621 XP_010845081.1.44457 XP_010845082.1.44457 XP_011971166.1.54773 XP_011971167.1.54773 XP_011971168.1.54773 XP_012037217.1.66739 XP_012037218.1.66739 XP_012037219.1.66739 XP_017909561.1.57651 XP_017909562.1.57651 XP_017909563.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]