SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049112 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049112
Domain Number 1 Region: 13-171
Classification Level Classification E-value
Superfamily Nudix 8.12e-20
Family MutT-like 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049112   Gene: ENSBTAG00000018749   Transcript: ENSBTAT00000053197
Sequence length 195
Comment pep:known chromosome:UMD3.1:1:140044681:140046241:-1 gene:ENSBTAG00000018749 transcript:ENSBTAT00000053197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGG
FVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQL
TAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGL
LEPGSFARLKISTPP
Download sequence
Identical sequences A1A4Q9
XP_005202022.1.76553 ENSBTAP00000049112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]