SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049672 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049672
Domain Number 1 Region: 14-189
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-44
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 166-284
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049672   Gene: ENSBTAG00000018086   Transcript: ENSBTAT00000055485
Sequence length 436
Comment pep:known chromosome:UMD3.1:17:71459718:71470126:-1 gene:ENSBTAG00000018086 transcript:ENSBTAT00000055485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGKVK
LQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYR
PEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYYSEKLEAIQLDGEILFSLLQ
KVSPVAHKHLSQQKIDPLLYMTEWFMCAFSRTLPWSSVLRVWDMFFCEGVKIIFRVGLVL
LKQALGSPEKVRGCQGQYETIERLRSLNPKVMQEAFLVQEVVELPVTERQIEREHLIQLR
RWQETRGELQCPSPPRLHGAKAILEAEPGPRPSLQPSPSIRLPLDAPLSGSKGKSKASKQ
VQKEPREPARESGQRDQPPAASQAKAAAAAGDASPPQDMPVQDPAPQDPQGSAPRDSAHH
RSRESLTSQESEDTYL
Download sequence
Identical sequences F1MB46
ENSBTAP00000049672 ENSBTAP00000049672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]