SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049882 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049882
Domain Number 1 Region: 224-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 34-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 3 Region: 336-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 377-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 186-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000139
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 126-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000879
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049882   Gene: ENSBTAG00000038869   Transcript: ENSBTAT00000052562
Sequence length 433
Comment pep:known chromosome:UMD3.1:18:47532346:47545032:1 gene:ENSBTAG00000038869 transcript:ENSBTAT00000052562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGHIEAGMTSEAKEKALPSEDSVLLQEEEEMPRLQELVTFKDVAVDFTEEEWQHLDPSQ
RHLYREVMLENFGNLISLAGHLLSEPEMIFHFEQEDDVWMEETIPRSSYSGVRDENDGIL
SWPVSPGEKLYNCPQHGQDFSQLRNLLIHQQTHIGEKPSPYAMCGKAFSERTADLNLPVL
LPGDEPYRCMEYSGVFHSGSALRRHKKEHMGKKPHTCEECGKDFSRSSNLSIHRRVHTGE
KPYRCSVCGKDFSRSSNLSIHQRIHTGEKPFSCHECGKDFSRRAALQIHQSVHTGRKPHA
CEVCDRRFTSRSALARHQQGHAGDKAYLCDTCGRGFSQRANLYLHQRVHTGERPFRCEAC
GKCFSWSKDLGIHRRVHTGERPYRCAACGRDFRHHSALKRHQRVHTGEKPYLCAICGKGF
SQRVHLQMHQKVH
Download sequence
Identical sequences A6QQH4
ENSBTAP00000049882 9913.ENSBTAP00000049882 NP_001095702.1.59421 NP_001095702.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]