SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049908 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049908
Domain Number 1 Region: 24-62
Classification Level Classification E-value
Superfamily SAP domain 0.0000000989
Family SAP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 312-356
Classification Level Classification E-value
Superfamily EF-hand 0.0000172
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049908   Gene: ENSBTAG00000047537   Transcript: ENSBTAT00000053074
Sequence length 538
Comment pep:known chromosome:UMD3.1:28:25228951:25249032:1 gene:ENSBTAG00000047537 transcript:ENSBTAT00000053074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSKGLKSQLIARLTKQLK
VEEQKEEQKELEKSEKEEEEEDDRKSEDDKEEEERKRQEELERQRRERRYILPDEPAIVV
HPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLL
SLPEKEDKKEKEKKSKKDERKDKKEERDDETDEPKPKRRKSGDDKDKKEDRDERKKEDKR
KDDSKDDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEENKRDDKRDINRYCKERPSKDKE
KEKTQMITINRDLLMAFVYFDQSHCGYLLEKDLEEIFYTLGLHLSRAQVKKLLNKVVLRE
SCFYRKLTDTSKDEENHEESEALQEDMLGNRLLLPTPVVKQESKDVEENVGLIVYNGAMV
DVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDKDEKTILNLEISNKNLSGELREVKKDLSQ
LQENLKISENMNLQFENQLNKTIRNLSTVMDEIHTVLKKDNGKNEDKDQKSKENGASV
Download sequence
Identical sequences F1MMZ9
ENSBTAP00000049908 ENSBTAP00000049908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]