SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050922 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050922
Domain Number 1 Region: 103-307
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.00000000467
Further Details:      
 
Domain Number 2 Region: 565-693
Classification Level Classification E-value
Superfamily SH2 domain 1.85e-26
Family SH2 domain 0.00062
Further Details:      
 
Domain Number 3 Region: 712-768
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-21
Family SH3-domain 0.00061
Further Details:      
 
Domain Number 4 Region: 312-393
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000347
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 5 Region: 515-587
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000291
Family SH3-domain 0.0000207
Further Details:      
 
Domain Number 6 Region: 1-66
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000365
Family Calponin-homology domain, CH-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050922   Gene: ENSBTAG00000039160   Transcript: ENSBTAT00000056825
Sequence length 774
Comment pep:known_by_projection chromosome:UMD3.1:7:18866561:18937070:-1 gene:ENSBTAG00000039160 transcript:ENSBTAT00000056825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFLCLKNIRTFLSTCYEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNKGIM
PFPTEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEVYEDLMRSEPVPMPPK
MTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDVEIIFINIEDLLRVHT
HFLKEMKEALANPGASTLYQVFIKYKERFLIYGRYCSQVESASKHLDRVATAREDVQMKL
EECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKDNLRLALDAMRDLAQ
CVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKMDRYAFLLD
KALLICKRRGDTYDLKDFVNLHSFQVRDDSSGERDNKKGSEVVTGRPQCWGPSMPLELST
WPLECLCVCVCDLALKHVYYHMGLPGGSDDKESASNAGDLGLIPVLGRPPWRRAWQSLRY
SCLKNSMGRGPGIQVTSSCSTSLLPLGIPWASLYHPLPSPPGLPKMEVCQEYYGLPPPPG
AIGPFLRLNPGDIVELTKAEAEQNWWEGRNISTNEVGWFPCNRVKPYVHGPPQDLSVHLW
YAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITE
KKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAINKPSAGSIKIFGTAKARY
DFCARDRSELSLKEGDIVKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYSEYC
Download sequence
Identical sequences F1MR20
ENSBTAP00000050922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]