SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053286 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053286
Domain Number 1 Region: 1015-1104
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-26
Family PDZ domain 0.00027
Further Details:      
 
Domain Number 2 Region: 835-937
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-24
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 395-498
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-23
Family PDZ domain 0.0000571
Further Details:      
 
Domain Number 4 Region: 698-810
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 553-662
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-17
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 6 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000371
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000127
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000223
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053286   Gene: ENSBTAG00000019611   Transcript: ENSBTAT00000061528
Sequence length 1474
Comment pep:known_by_projection chromosome:UMD3.1:3:29849955:30117829:-1 gene:ENSBTAG00000019611 transcript:ENSBTAT00000061528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGAPGDLGAEIRGGAERGEFPYLGRLREDPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGTLLES
GTYDGNFYGTPKPPAEPSPFQADPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAVNGSGNAENRERHSEPSDWIKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQADTGSSKPDTEKSHFTRDPSQLKGILVRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDNEDPVVDIVAATPVINGQSLTKGETCMNTQDFKSGAVVLDQ
NGKSGHSLISDRFNGASDLSEQRASMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKLKTDKKETSESLEAINEPVPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFPSTQNGSPRLNRAEV
LARPAPQEPYDVVLQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHLGPPSGTNSARQSPALQHRP
MGQSQANHIPGDRSATEGEIGKDVSISYRHSWSDHKHLAQPDTATISVVGGRHNQGLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDTNSPPSPNVIYDEQSPCHPPSHSASIF
EESHVPVTEESLMRVQICEKAEELKDTVPEKKSTLNENQSDIKHKSLLHKNVNKRDPPNS
HGHGDKKNLLKAENGITPRGRSASPKKSASQHLEEHAGKIPSPLKNDPKRRPRDRSLSPR
KGENKSSQLGVGTASGQDHCGKSRGRSSSPKKQQKTEGSKDQSNASRRAGGHASDSAEQI
SDAKERSGVFGRDTNLSQPGKNRTRSPEKKSKRVDERSLPSKKTNNVTSRAIPENERGKK
ATSGQMSSSKDKTGENVRISEKKLKQEPDERMALSKTEDHKRKELEVADKNKEGGGFKPE
SGSPAKKTPITPGPWKVPSASRAAGATGVAEKRL
Download sequence
Identical sequences E1BM96
NP_001179675.1.59421 NP_001179675.1.76553 ENSBTAP00000053286 ENSBTAP00000053286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]