SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053387 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053387
Domain Number 1 Region: 1065-1116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000093
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 566-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000044
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 498-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000203
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 623-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000152
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 5 Region: 1021-1073
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000322
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 6 Region: 248-272,464-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000185
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 650-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000512
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053387   Gene: ENSBTAG00000010130   Transcript: ENSBTAT00000061303
Sequence length 1346
Comment pep:known_by_projection chromosome:UMD3.1:13:75416920:75435377:-1 gene:ENSBTAG00000010130 transcript:ENSBTAT00000061303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENEVESSSDAAPRPGRPEEPTESGLGVGTSEAVSADSSDAAAAPGPAEADDSGVGQSS
DRGSSSLEEVSESSSTTDPLPHGYLPDSSSVSRGPAAGVMGGPPALVHSSALPDPNMLVS
DCTASSSDLGSAIDKIIESTIGTDLIRSCITVTSAEGSGAEATRYLILQGPDDGAPMASP
MSSSTLAHSLAAIEALADGPTSTSTCLEPPEEAQGGPSSPAQPPLGSGTEEPDLQSLEAM
MEVVVVQQFKCKMCQYRSSTKATLLRHMRERHFRPGALIAVAAGKKGRPRKWGSSAQPQE
EEGPEEEDDDDIIDAGAIDDLEEDSDYNPADDEPRGRQLRAQRPTPSTLRPRRRPGRPRK
LPRLETLDLPDGVEGEPLVSPQSGQSPLEPQDPEAPSSSGRGRLVALGKANRAPVEPSVS
QSDARSAAASYQDEADALPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPFLCRICGSRFLS
HEDLRFHVNSHEAGNPQLFRCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDKCSYTSVYRK
DVIRHAAVHSRDRKKRPDPTPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKCG
KSFKKRYTFKMHLLTHIQAVANRRFKCEFCEFVCEDKKALLNHQLSHVSDKPFKCSFCPY
RTFREDFLLSHVAVKHTGAKPFACEYCHFSTRHKKNLRLHVRCRHASSFEDWGRRHPEEP
PSRRRPFFSLQQIEELKQQHSTAPGPPASSPGPPEIPSEAAPSQSPETPPLLCSDTLGGA
TIIYQPGTAESTAVATQTALDLLLNMSTQRELGGTALQVAVVKSEDVEAGLVSSGGQPSP
AGTTPQVVTLHMADPGGSVAAESQLAPPDLQQITLAPGPFGGAGYSVITAPTVEEGTSTP
GTPYSEEPPGEAAQTVVVGDTLKEAGTHFIMAADGTQLHHIQLTADSSISFPSTEALASG
AKWPLLQYGGLPRDGPEPPAPARTHQPRDPQGSASPPPAASKPLGLVVPPSPPSAATASS
KKFSCKICAEAFTGRAEMESHKRAHAGPGAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQ
CSQCSFASKNKKDLRRHMLTHTNEKPFECQLCGQRFNRNGHLKFHIQRLHSPDGRKTAAP
TARAPARPPTQTIILNSDDETLATLHTAFQSSHGVLGPERLQQALGQEHIFVAQEQTVSN
PEEAAYIQEITTADGQMVQHLVASDSQVQYIISPDGVQQLLPQEYVVVPEGHHIQVQEGQ
ITHIQYEQGAPFLQESQIQYVPVSPGQQLVTQAQLEAAAHSAVTAVADAAMAQAQGLFGT
EEAVPEHIQQLQHQGIEYDVITLSDD
Download sequence
Identical sequences E1BPQ2
ENSBTAP00000053387 ENSBTAP00000053387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]