SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053594 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053594
Domain Number 1 Region: 203-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-33
Family APC10-like 0.0024
Further Details:      
 
Domain Number 2 Region: 1819-1879
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000177
Family ZZ domain 0.0065
Further Details:      
 
Domain Number 3 Region: 1777-1828
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 91-159
Classification Level Classification E-value
Superfamily EF-hand 0.0000101
Family Polcalcin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053594   Gene: ENSBTAG00000016316   Transcript: ENSBTAT00000061398
Sequence length 2962
Comment pep:known_by_projection chromosome:UMD3.1:19:25230019:25322722:-1 gene:ENSBTAG00000016316 transcript:ENSBTAT00000061398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSHSSEDEAAAAGGEGWGPHQDWAADSGTTPGQGPAAPALPPAAALLEPARLREAA
AALRPTPPCESLVSRHHGALLRWLEERLGRGEESVTLEQFGELLEARGAGFSGERFEEAF
AQFDAEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEGLD
VHAAMILRFLHRNRLSSTVIPYPMLDHCNNMSTMRASVLRESLDQLVQKEKESPGDLTRS
PEMDKLKSVAKCYAYIETSSNPADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRH
LSIAVAATDQSYMPQQVTVAVGRTASDLQEVRDVHIPSNVTGYVTLLENANISQLYVQIN
IKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
VLRNTQKALQHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCRSTPEVELTLLAFA
LARGSVAKVLSSLCTVTDHLDTHYDASSLISSMASVRQNLLLKYGKPLQLTLQACDVKGK
EEKSGPENLLAEPWTRDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGL
VFAYNSSSDKFHAEEHFKRFEKYDKWKLQEFRQFVKSRIGCSSDILGEDDPIGWFELEEE
WDEADVKLQQCRVAKYLMVKFLCTRQESAERLGVQGLSISGYLRPARAEAEQSIICAHCR
KSTEESVCGATLLLKTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQ
NPREECICAQTLLLQLLQSCFSVLQGDAPAAAEDAKAPSPRPRPVEAAKELYAHLCSVVD
RLDGDSVPMEILKQEVRNTLLNGAAIFFPDRLTRRNHLFTMMNVTEQEHKQSMQLTFRSL
CTYFSDKDPGGLLLLPEKGDLADMDISEVLAVMNTLLSVAARECELLMVDGAQREVGSVL
SSLFWSVQGSLLSWCYLQLKSTDSGAKDLAADLTDRYVGQFLAHVRVILESLLSQYSGKT
IVEKLCNSVFSMAARQLVIFLLDFCTLDISHCTLLREFSALTELLKELCSDPEGGVNKLD
VETWQQERPVVLHTWTKESAHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEF
TDARGGKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAV
SWGLDLQLLVSRLMGRLASQCMALKSVHQLGSNMAVPQAKMALVLNSPLWKPVFRHQIHP
ELGLEASWPTHPPQDNKEVKNIPDDHCHQFLLDFAQSDPAQNFCGPYSELFKGFIQACRK
QAPKTDIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVNSGGKTALSEEFAQVYSLADG
IRIWMLEMKQKSLMNLGSEAEEQRDPEAAEANPESLAKECYQKSLLLLKFLPTGGGSKES
CDRSVAVDDTDHLQPLDKRQRTSSVVEEHFQASASPTEAAPPTAGDRSPGPDMQPTLPPS
SGAPALEVSSVPAEEPSSPSTPTRRPPFTRGRLRLLSFRSMEEARPAPTVKEKYPVLKDL
MDFIKDQSLSHESVVKVLSLRKAQAWSILEVLRIIQCCTESLGQPHCFHPPYILFLLELL
TCQKEFTNYFGHLEGCGADLHKEIRDTYYQFVLFLVKAVKGFNSKNDRSLLPALSCIQTA
LLHLLDMGWEPSDLTFFVDIQLPDLLMKMSQENISAHDSVISQWSEEDELADAKQNSEWM
DECQDGMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQC
SDMDLCKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMHCNVCDDFDLCYGCYA
AKKYSYGHLPTHSITAHPMVTIRISDRQRLIQPYIHNYSWLLFAALALYSAHLASAEDVD
GEKLDPQVRSSAATLRSRCLQLVGDCLMKAHQGKGLKALALLGVLPDGGSPLENQALPVT
APTQTSEEQPEKKAVQAAAEPAPTGPGKRDGPKEVRPLDCKQRSKASEGVSLRKDPSCPP
QISDSPADACTPTGLPDAENSEASSQKPIEEKAVIPSPEQVFAECSQKRILGLLAAMLPP
LNSDPTVPLIDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLLPAEVDAAVTKV
LSAKHNLFAAGDSSVVPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNSAPLWR
DVVATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHF
TEKNRAVIVDVKTRKRKTVKDYQLVQKGGGQEGSDSQAQLSQYSQHFAFIASHLLQTSMD
SHCPEAVEATWVLSLALKGLYKTLKVHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWL
LRDLEILSIMLYSSKKEINTLAEHGELELDERGDQEEEVERSVSSPGDQEQKKLDPLESL
DEPTRICFLMAHDALNAPLHILRAIYELQMKRTDSFFLEVQKRFDGDELTTDERIRTLAQ
RWQPSRSLRLDEQSAKAVDTDMIILPCLSRPVRCEQATVESNPVTQKLISSTESELQQSY
AKQRRSKSAALLHKELNCKSKRAVREYLFRVNEATAVLYARHVLASLLAEWPGHVPVSED
ILELSGPAHMTYILDMFMQLEDRHQWEKILQKVLQGCRESMLGTMALAACQFMEEPGMEV
QVRESKHPYNNNTNFEDKVHIPGAIYLSIKFDPQCNTEEGCDELAMSSSSDFQQDRHNFS
GSQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLGRFQTGFEILKQMLSEERVV
PYLPLAKIWEWLVGVACRQTGHQRLKAIHLLLRIVRCCTHSDLCDLTLLKPLWQLFTQME
YSLFEDVTQAGILLPLHRALTELFFVTENRAQELGLLQDYLLALTTDDHLLRCAAQALQN
IAAISLAINYPNKATRLWNVEC
Download sequence
Identical sequences E1BNA9
ENSBTAP00000053594 ENSBTAP00000053594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]