SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053832 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053832
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000106
Family SAM (sterile alpha motif) domain 0.0078
Further Details:      
 
Domain Number 2 Region: 698-861
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000725
Family Nitrogenase iron protein-like 0.073
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000053832
Domain Number - Region: 1085-1120
Classification Level Classification E-value
Superfamily TPR-like 0.0482
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053832   Gene: ENSBTAG00000012894   Transcript: ENSBTAT00000061545
Sequence length 1581
Comment pep:known_by_projection chromosome:UMD3.1:4:10302667:10307412:-1 gene:ENSBTAG00000012894 transcript:ENSBTAT00000061545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQLNLPENTDDWTKEDVNQWLESHKIEQKHRAILTAQDVSGAILKYLTKDHLVAMGIT
FGPAIQIEQLFKELLETSSGDPFQTCKSGKGSKSVPKTQQKDGGTSKQKNKKKSDKVNDS
TVSTVTKGSKSLKNEFMEDEIDDTKKKQPSTEPTCMAYPFDEFSDPYRYKLNFKLQPETG
PLNLIDPIHEFKAFTNTETGTEEDAKMKFSNEVFRFASACMNSRTNGTIHFGVKDKPHGT
IVGVEFTTITKEALIDHFNLMIHQYFEDHQVQKAKNCIREPRFVEVLLPNSTLSDRFVIE
VDVVPKYSECEVDYFQIKMQNCSNTIWKQSPNFSVFVRDGASSKDIMKSNMDFKAFKLDL
KRLAESRKEAEEKCRVKTNKKESEGPKLVKLLTGNQDLLDNSYYDWYILVINKCHPTQIK
HLDFLKEIKWFAVLEFDPESVSKGVVKAYKETRVVNLHFPSLYVEGKTTTEKITSLNLYQ
QLSWIFCNGRLDLDSEEYKPLDASSWQREKASEVRKLISFLTQEDIMPRGKFLVVFLLLS
SVDDPRDPLIETFCAFYQDLKGMENILCICVDSRICQGWKDLLEARLTTQQDELSNQCVS
SLSLEEINGTILKLKSVTQSSKRFLPSIGSSTVLLKKEEDIMTALEILCENECEDTILEK
DKKKLLEFKALKEEDFYRGGKVTWWNFYFSSENYSSPFVKRDKYEKLEEMIQRGADSSKS
TCVKIIHLYHHPGCGGTTLAMHILWELRKKFRCAVLKNKTVDFSEIGEQVTNLITYGTTN
NQEYLPILLLVDDFEEQDNVYLLQASIHTAVANRYIRYEKPLVIILNCRRSQNPEKSAKI
SDSIALIQQLSPKEQRAFELKLKEIEDQHKNFQDFYSFMIMKTNFNKKYIEDVVRNILKE
QNISTKEAKLFSFLALLNSYVPDTTISLSQCEKFLGITSKKAFWGTEKFEDKMGTYSTIL
IKTEVVECGNYCGVRIIHPLIAIRSLEELKISYDLDKSQITLDMLTENLFYDTGIGRSKF
LEDVQTLLLTRQRNENEGEMGTLFSPFIEALHKEEGNVAVKNVLRGGIRRFNPNAFICQA
LTRHFYIKEKDFDSALHWANQAKKIEPDNSYISDTLGQVFKSKIRWWMDDNERNRSISVG
ELSDLLDLAVQASNAFKESQQQSEDREYEGKERFYQKSKRRYDTYNTAGYLGEIEVGLYT
IQILQFIPFFDNKNELSKRDMINFISGSKDIPGEANNEFKLVLKNFISYLTNLKFSLKKS
FDFFDEYFVLLKPRNNIKQNEEAKTRRKVAGYFKKYADIFGPSEELQNKDFGSKLSVPLQ
VELYRRSLEVLKADKFSGLLEYLIKAQEDAVHTMEDIMDKYTFLFEQCTVKILIKEKQNF
ILANIILYCIKPTSKIVKPIKKLKDQLRELLQQTGMSYRYPEPYFLASLLFWPENQQLDQ
DSRLMEKYASSLENSFRGQYKHMYRTKQPIAYFFLGKGNSVNRLVHKGKIDQCFEKTADI
NFLWQSGDVWKEKKVQKLLLRLKGRVGNNCLHIEYGINEKITIPITPAFLGQLRSGRSIE
KVSFYLGFSIGGPLAYDIEII
Download sequence
Identical sequences F1MF27
NP_001192710.1.59421 NP_001192710.1.76553 XP_005205200.1.76553 XP_005205201.1.76553 XP_010802300.1.76553 ENSBTAP00000053832 ENSBTAP00000053832 9913.ENSBTAP00000053832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]