SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053920 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053920
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-34
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 219-277
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 751-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.88e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 474-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-16
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 828-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 966-1018
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 583-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000703
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000945
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 9 Region: 511-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000199
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 10 Region: 875-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000179
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053920   Gene: ENSBTAG00000046301   Transcript: ENSBTAT00000065626
Sequence length 1021
Comment pep:novel chromosome:UMD3.1:22:16367996:16376583:-1 gene:ENSBTAG00000046301 transcript:ENSBTAT00000065626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYAVHPAQAKASRERGRLQMVKKEEEDESYTSVPAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPEELRTWVQLHHP
ESGGEAVALLEELQRDFDETPWRDPAPAQSPDVHWMGTGALRAAQIWPPASPLRSGSALG
DHLQPPYEIGVRDFLAGQPDPPAAQVPALCSKEGCADNQGTMTFKDVEVTFSQDEWGLLD
ASQRNLYRDVMLENYGNMASVVGPFTKPALISWLEAREPWGLNVQGVQFKGNPGAAPAGD
ELHVKTDKFILKPEPLEEAVTLAMPSGCHGAATVSEGPGLRESIAQKSGLKERCGNPTQV
RVKKEETNSSHGAGKDCEDSGRSNSLHLRHITYLRGPRRKQSLKHGYGKHFRGSSYHYDY
KEYGKGLRRMMGGFSLHQRIHAGLKGKAKDAHGKDFSLSSHHQHGQNLHVVGTLYKCSDC
GRTFSRSSHLVCHQRLHTQEKPFKCRACGKAFRWSSNRVRHEKIHTRLKPYKCSLCDKAF
RRMSVYRLHQETHAKQKYLESTQDEEALTCVSDFDHHLRDQSGERLFDCSQCRKSFHCKS
YILEHQRIHTQEKPYKCPKCRKTFRWRSNFTRHMRLHQEEKFYDLDKCREELRQTSNSSQ
PQSAPTMEKALVCQQCGKTFIRKKTLINHQRIHTGEKPYRCHECAEEFPHRSAYIVHKRQ
HATKRKPEDAPSFSHDRAFQVPQTSPTTEEPYKCSQCGKVFRNHSFLLIHQRVHTREKPY
KCKECGKSFRWSSNLSRHQRTHSLGKLDEYSESEDALNLQSQVLTGAKPFQCQECGKNFT
RKRSLLDHEGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHTKERPFKCQCCGKDFIGKHT
LSIHQRKHIRAAQSENGVAGLSSCQETGVKLHELKSGQENPLEDDEKTCNQRSELPGLQD
IPTRGKCHKCSTCGKTFSKSSQLISHKRFHTRERPFKCRVCGKTFRWSSNLARHMKNHIR
D
Download sequence
Identical sequences G3MWL9
ENSBTAP00000053920 ENSBTAP00000053920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]