SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054153 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054153
Domain Number 1 Region: 36-93
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 82-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 2-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 167-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000819
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054153   Gene: ENSBTAG00000047405   Transcript: ENSBTAT00000063641
Sequence length 278
Comment pep:known_by_projection chromosome:UMD3.1:18:65798025:65798861:1 gene:ENSBTAG00000047405 transcript:ENSBTAT00000063641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACKECGKAFSQNSSLVQHERIHTGHKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYACQD
CGRAFNQNSSLGRHRRTHTGEKPFACSVCGKAFSRTTCLFLHLRTHTAERPYECSRCGKG
FRHSSSLAQHQRKHAGDGPYDCRQRLLFAPAPSWPEPLSPGEGPPRSDRPFRCSQCGKGF
TQSSHLIRHQITHTREQPRGRGRRRPQVRSRGGHLGRRPLGPPEESPGGGTKAGPPAGRA
LALFDLHEIMQEKNPVRVIGVEEPAMSTSVLFDIREST
Download sequence
Identical sequences G3MX92
ENSBTAP00000054153 ENSBTAP00000054153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]