SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054275 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054275
Domain Number 1 Region: 15-239
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-67
Family Eukaryotic proteases 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054275   Gene: ENSBTAG00000046105   Transcript: ENSBTAT00000064845
Sequence length 247
Comment pep:known_by_projection chromosome:UMD3.1:7:44981793:44984484:1 gene:ENSBTAG00000046105 transcript:ENSBTAT00000064845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQKRRLPLTPASPGAARAVEIVGGREAQPHSRPYVASLQLASGSHFCGGTLVHPSFVLTA
AHCLNNLNPQRVRVVLGAHRLQTPEPTQQRLGISRLFENNYNPQEKLNDVLLLQLDQPAT
LNTHVAVAQLPQQAQPLPHGTQCLAMGWGRLGTLEPLPQVLQELNVTVVTFLCRPQNVCT
YVPRRSAGICFGDSGGPLICNGVLHGVDSFVIRGCATGQYPDFFARVSLYVDWINSVLSS
VGGKDSP
Download sequence
Identical sequences G3MXK8
ENSBTAP00000054275 ENSBTAP00000054275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]