SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054347 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054347
Domain Number 1 Region: 782-1075
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.24e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000209
Further Details:      
 
Domain Number 2 Region: 61-322
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.14e-80
Family Carbonic anhydrase 0.00000701
Further Details:      
 
Domain Number 3 Region: 1079-1365
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.8e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 349-443
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000544
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054347   Gene: ENSBTAG00000021911   Transcript: ENSBTAT00000063448
Sequence length 1400
Comment pep:known chromosome:UMD3.1:22:39175354:40360572:-1 gene:ENSBTAG00000021911 transcript:ENSBTAT00000063448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGTLHENRQGSSVQAQIRRRKASGDP
YWAYSGAYGPEYWVTSSVSCGGRQQSPIDISDQHARVSEEYQDLQLDGFDNESSNKTWMK
NTGKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFF
YNPDDFDSFQTAISENRIIGAMAVFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFIL
RDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKS
VEYLRNNFRPQQGLNNRVVYKSAIRDAWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPL
NQTALQVSWSQPETIYHPPIMNYMVSYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSL
YLFRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSS
TWTSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFSGGGISSFPSTVWPTRL
PTAASASKQAGRPVLATTEALASPGADGDSAPSKDGEGAEESEKDEKSESEDGEREHEEE
GEKDSEKKERSGVTHAPRARNHTQPTAAPSAPGTAAQEGAHQTTSGRERARTAIPTARPQ
DALDPLSVTPTQVPPTNTSGMISRPSPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGC
NKIKSKGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDM
EAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILA
YDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTG
IIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKVHACYTVRHFSVRNTKVKKGQ
KGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARTPEMGPVLVHCSAGVG
RTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKET
EVSSSQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVV
PSERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQI
IVMLPDNQSLAEDEFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQD
DYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALT
TLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDR
NGAALTADESDPAESMESLV
Download sequence
Identical sequences G3MXS7
ENSBTAP00000054347 ENSBTAP00000054347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]