SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054539 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054539
Domain Number 1 Region: 306-426
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000028
Family Eukaryotic proteases 0.078
Further Details:      
 
Domain Number 2 Region: 25-54,183-287
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000201
Family Prokaryotic proteases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054539   Gene: ENSBTAG00000038845   Transcript: ENSBTAT00000063074
Sequence length 569
Comment pep:known_by_projection chromosome:UMD3.1:28:26531082:26537924:-1 gene:ENSBTAG00000038845 transcript:ENSBTAT00000063074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQWGPAMRAAEQAGCVVSASRAGQPEAGSWSCSGVILNRRPGLVLCHGGIFTPFLRAG
SGALTAASTAFLPGDSCGDDLRLHVQCGPTAASPAGRAERGRPGLCTPQCAGLEPGPPAR
PRGRPLQPPRPAELLLLLSCPAFRGHFVRLFGGEEAEQWRFANAAPDDEVSEEEEEDQLR
ALGWFALLRVRPEMEKEAEERGPVLAVAPLGDVPKGAPLLACGSPFGAFCPDIFLNTLSR
GVLSNSAGPLLLTDARCLPGTEGGGVFASRPAGALVALVAAPLCWKAREWVGLTLLCAAA
PLLSVARAALCRLHPDTAALAALLPPEMGAPWGLPLRYRDPGPPWAAAAVLVECGSVWGS
GVAVAPHLVVTCRHVAPRETARVLVHSTTPKSAIIWGRVVFATQETSPYDIAVVRLEEDL
DGVPVPVPAEHFHEGNEQRVPLVRGLPAVLSMPTVLGGRWNSQRKIKEVPDVLVCGCDLL
GFIFTNRLFSPRSSDSLCIVASNTRDNNTGATYPHLNFSIPITVLQPALQQYSQTGDLGG
FRQLDRASEPVRVVWRLQRPPAEALRSKL
Download sequence
Identical sequences G3MYB0
ENSBTAP00000054539 ENSBTAP00000054539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]