SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054949 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054949
Domain Number 1 Region: 5262-5420
Classification Level Classification E-value
Superfamily SET domain 9.16e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1357-1417
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 272-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000115
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1432-1500
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000109
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1311-1365
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000115
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000132
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 1962-2012
Classification Level Classification E-value
Superfamily HMG-box 0.00000279
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054949   Gene: ENSBTAG00000014429   Transcript: ENSBTAT00000063707
Sequence length 5420
Comment pep:known_by_projection chromosome:UMD3.1:5:30931917:30964080:1 gene:ENSBTAG00000014429 transcript:ENSBTAT00000063707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPKPPGEDKDSEPAADGPAASEESGATEPDLPKPHVGEVSVPSSGGPRLQEPPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGNPGPSEGALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCSRLYHFPCATASGSFLSMKTLQLLCPEHSEGATHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAPGGQPVSS
LAEQHPPVCSRFSPLEPGATPTDEPNSLYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
REGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEDSPTSPPPEASRLSPPPEDSPLSPPP
EESPLSPPQDSPPHPPLDTPLPPPPEASPLSPPLEESPLSPPPEELPTSPPPEASRLSPP
PEESPMSPPPEESPMSPPPEASCLFPPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPM
SPPPEDLPMSPPPEVSRLSPPPEESPLSPPPEESPTSPPPEASRLSPPPEDSPTSPPPED
PPASPPPEDLLVSLPLEESPLLPLPEELRLCPRPEEPHLSPQPEKPRLSPAPQEPRLSPA
SQEPRLSPAPQEPCLSPAPEEPRLSPAPQQPCLSPAPEEPRLSPAPQQPHLSPVPEEPRL
SPRPEEPRLTPRPEEPHLSPRPEEPIEEPSLCLASEELPLLLPPREPPLSPVLGEPALSE
PGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITTVAPPALSPLGELEYPFD
AKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPMGPASPILMEPLPP
RCSPLLQHSLPPSNSPPSQCSPALPLLVPSPLSPMDKAVEVSEEAEPQKMETEKAPEPEC
PALEPSPTSPLPSPLGNLSCPAPSPAPALDDFCGLGEDTAPLDGTDTPGSQPEAGQTPGS
LASELKGSPVLLDSEELAPVTPMEVYGPECKQAGQGSPCEEQEEPRAPVAPTPPILIKSD
IVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDS
LPETDDSLLCDAGTAIGGGKAEGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRG
RGRARLKSTTSSIETLVVADIDSSPSKEEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVC
GSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLL
LCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCAS
LVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVKP
AAPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRPGLPGE
AGLEGAEPSEVLGPDDKKDGDLDTDELLKAEGSVEHMECEIKLEGPVSPDGEPGKEETEE
SKKRKRKPYRPGIGGFMVRQRKSHTRVKKGPAAQAEVLSGDGQPDEVLPADLPAEGSVDQ
GLADGDEKKKQQRRGRKKNKLEDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGT
PKAKGDGGSERKELPTSQKGDDGPDVADEESRGPEGKADTPAIAGPEDGGIKASPVPSDP
EKPGTPGEGMLSSDLDRIPTEELPKMESKDLQQLFKDVLGSEREQHLGCGTPGLDGSRTP
LQRPFLQGGLPLGNLPSNSPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTT
PSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPSLKQDYPDWSS
RCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDMARKTDRP
ALHLRIPPQPGALGSPPPAAAPTIFIGSPTPPAGLSTSADGFLKPPAGTVPGPDSPGELF
LKLPPQVPAQVPSQDPFGLASAYALEPRFPTAPPTYPPYPSPTGAPAPPPTLGASSRPGT
GQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGGGGSKAAEPLLSPLPFGE
SRKALEVKKEELGGSSPSYGPPNLGFVDSPSSGPHLGGLELKAPDVFKAPLTPRASQVEP
QSPGLGLRPQEPPPAQALAPSPPSHSDIFRPGPYPDPYAQPPLTPRPQPPPPESCCALPP
RSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSR
DPFAPLHKPPRPQPSEVAFKAGPLAHTPLGAGGFPAALPSGPAGELHAKVPSVQPPNFAR
SPGTSAFVGAPSPMRFTFPQAVGEPPLKPPVPQPGLPPPHGINSHFGPGPTMGKPQSTNY
AVAAGNFRPSGSPLGPSSGPAGEGYGPSPLRPPSVLPQPTPDGPLPCLPHGATQRAGITS
PVEKREDPGAGTGSSLAAPELSGTQDPGMSGLSQTELEKQRQRQRLRELLIRQQMQRNTL
RQEKETAAAAGAVGPPGNWGAEPSSPAFEQLGRGQTPFAGTQDKSSLVGLPPSKLGGPIL
GPGAFPSDDRLSRPPPPATPSSMDVNSRQLVGGSQAFYQRAPYPGSLPLQQQQQQQLWQQ
QQQATAAASMRLTMSARFPSTPGPELGRQTLGSPLAGISNRLPGPGEPVPGPAGPAQFIE
LRHNVQKGLGPGGPPFPGQGPPQRPRFYPVTEDSHRLAPEGLRGLAVSGLPPQKPSAPPA
PELNNSLHPTPHTKGPNLPTGLELVSRPPSSTELGRPPPLTLEAGKLPCEDPELDDDFDA
HKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDT
GDKKDIFNEHLRLVESANEKAEREALLRGVEPGPFGPEERPPPAADASEPRLASGLPEVK
PKVEEGGRHPSPCQFTITTPKAELAPVTTSLGLGVKPGQSVTGSRDTRMGTGPFSSSGHT
AEKVPFGTTGGPPAHLLTPSPLSGPGGSSLLEKFELESGALTLPGGHASGDELDKMESSL
VASELPLLIEDLLEHEKKELQKKQQLSAQLQPVQQQQPQQHSLLSTPGPGQAVSLPHEGS
SPSLAGPQQQLALGLGGSRQPGLAQPLMPNQPPAHALQQRLAPSMAMVSNQGHMLSGQHG
GQAGLVPQQNPQPVLAQKPMGTVPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIID
PIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAAGSGQER
GAGDSSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKAL
CAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQ
QQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPPGGQAAGLRLTPGGM
ALPGQPGGPFLNTTLAQQQQQQHSGGAGALAGPSGGFFPGNLALRGLGPDSRLLQERQLQ
LQQQRMQLAQKLQQQQQQHLLGQVAIQQQQQQGPGVQANQALGPKPQGLLPPSSHQGLLV
QQLSPQPPPGPQGMLGPAQVAVLQQQQPHPGALGPQGPHRQVLLTQPRVLSSPQMAQQGQ
GLMGHRLVTSQQQQQQQHQQQGSMAGLSHLQQGLMPHSGQPKVGAQPMAALQQQQLQQQQ
QQQQQQQQQLQQQQQIGLLSQSRALLSPQQQQQQQQMTLGPGMPAKPLQHFSSPGALGPT
LILTGKEQSIVETALPSEASEGSSTHQGGPLPMGTVPESVAPEPGEVKPSLSGDSQLLLV
QPQAQPQPNSLQLQPPLRLPGQQQPPVNLLHTAGAGSHGQPGSGSSEASSVPHLLAQSSV
SLGEQPGSVTQNLLSSQQPLGLERPMQNNIGPQPAKPGSVPQSGQSLPGAGVMPTVGQLR
AQLQGVLAKNPQLRHLSPQQQQQLHALLMQRQLQQSQAARQAPPYQEPGTQPSPLQGLLG
RQPQLGGFPGSQTGPLQELGAGLRPQGPPRLPAPQGALSTGPVLGPVHPTPPPSSPQEPK
RPSSQLPSPSSQLPSEAQLPTTQPGTPKPQGPPLELPPGRVSPAAAQLADTFFGKGLGPW
DPPDHLAEAQKLEQSSLVPGHLDQVNGQVVPEPPHLNIKQEPREEPCALGSQAVKREANG
EPVGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGPEGLRAEINGHIDSKLAG
LEQKPQGTPSTKEDTAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQ
ELSLLPLTEPTITANFSLFAPFGSGCPISGQCQLRGAFGSGVLPTGPDYYSQLLTKNNLS
NPPTPPSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAACARDTEGVLRDASEVKSLDLL
AALPTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSGRWEQDDRAL
SPVIPIIPRASIPVFPESKPYGVLDLETTRKLPAPTWEKGKGSEVSVMLTVSAAAAKNLN
GMMVAVAELLSMKIPNSYEVLFPESPARAGIEPKKGEAEGPGGKEKSLGGKSPEAGPDWL
KQFDAVLPGYTLKSQLDILSLLKQESPAPEPPAQHSYTYNVSNLDVRQLSAPPPEEPSPP
PSPLAPSPASPPAEPLVELPAEPSAEPPIPSPLPLASSPESTRPKPRARPPEEGEDSRPP
RLKKWKGVRWKRLRLLLTIQKGGVRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHE
EGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQR
TGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYI
ERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYW
SLRTNNRRCCYRCSIGENNGRPEFVIKVMEQGLEDMVFTDASPQAVWNRIIEPVAAMRKE
ADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTG
CARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKN
NVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINN
EHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFE
DDQHKIPCHCGAWNCRKWMN
Download sequence
Identical sequences G3MZF2
ENSBTAP00000054949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]