SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055045 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055045
Domain Number 1 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 244-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.85e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 350-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000817
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 213-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000468
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 1-32
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000353
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 6 Region: 160-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000532
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055045   Gene: ENSBTAG00000046071   Transcript: ENSBTAT00000063527
Sequence length 400
Comment pep:novel chromosome:UMD3.1:27:6476079:6478832:1 gene:ENSBTAG00000046071 transcript:ENSBTAT00000063527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEWNLLDKSQKNLFRNVMLETVTHLVSVGESVNRDVPAPVSILLEQGTELWTEAAGGLQG
QSPGERQGPGLQSKTVSAGVLSPSRHQIDSCSDPAISCFFHHFLTQCLVTTLHCYISILV
FFSNAVKDPLKIRNHIYAKCLQKAHILYYVSSKFQGWEPQSSKRKTQQCDNKQCGKSCSQ
GSFLNAHGPIHTRGKSCECPLCRKVLIITLASDHRMIHTGEKPNKCGLCGNGYFLRNHNW
VHTGEKRFECHVCGKLFKVPTWNIRKHTGEKPYKCRLCEKSFHQISFLRKHEKLHPKEKH
YECCQCGVFSQSSGLSQHKRIHSGEKPQVCLVCGKAFSQSSGLTRHKRTHTGEKLYKCQR
CGNTFSQYANLRRHERTQMGEQPYECQLCGKCCSHSSSLR
Download sequence
Identical sequences G3MZP3
ENSBTAP00000055045 ENSBTAP00000055045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]