SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055314 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055314
Domain Number 1 Region: 20-286
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-82
Family Eukaryotic proteases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055314   Gene: ENSBTAG00000015045   Transcript: ENSBTAT00000064680
Sequence length 314
Comment pep:known_by_projection chromosome:UMD3.1:25:2242556:2247180:-1 gene:ENSBTAG00000015045 transcript:ENSBTAT00000064680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPQGAALLLAQLLVRIEIAEQAAQPGVRLSIPGPCGQRVIPTRIVGGKDATIGHWPWQG
SLRLWGYHFCGASLLNRRWALSAAHCFENNRNPFHWSVQFGELSAAPSIWNLQAYYNRYN
VDQIFLSPHYLGAPVYDIALLKLSSSVTYTKYIQPICVMASISEFENRSDCWVTGWGDIE
EELSLPSPYTLQEVQVGIINTTMCNHLFSMPDFRIDIWGDMICAGEPQGGKDSCFGDSGG
PLVCEKKGLWYQVGVVSWGVGCGRPNRPGVYTNISVHYKWIREVLAQNNTCRLDSCLMLL
LLPLLWALPFLQLA
Download sequence
Identical sequences G3N0F4
ENSBTAP00000055314 ENSBTAP00000055314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]