SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055562 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055562
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000477
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 503-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000754
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 735-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000809
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 553-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000326
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 643-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000013
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 596-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000844
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 798-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000109
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055562   Gene: ENSBTAG00000011646   Transcript: ENSBTAT00000065675
Sequence length 904
Comment pep:known_by_projection chromosome:UMD3.1:13:54353925:54359471:1 gene:ENSBTAG00000011646 transcript:ENSBTAT00000065675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRVPGSSRSGPGKDGSRNEVRLPVLHEPPKLGLPVVRAGQTVPSQAALCF
DLESPAGDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNAGCWLEFPSI
YGLKYHYQRCQGVRDCSLGKGKPGAHPALAVGLGGAISERLTFPCPFCEAAFTSKTQLEK
HRIWNHMDRPLPAPKPGPVSRPVTVSRPVGVSKPIGVSKPVTISKPIGISKPVTVSRPVP
VSKPVTVSRPVPVTKPVTISRPVPVTKAVPPVTVNKPVPVTKPVTINKSVPMTKLVTVTK
PVPVAKPVTVSRPIVVSKPVTVSRPIAISRHTPPCKVVLLTKSENKAPRAAGRSSGKKRT
ADGLDTCPIPPKHARPENGEYGPATPEQSSAFQLSTDPSSSPLSLGSRPSGGKEVPRAPG
PGSPPEEGAERVKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKARIHRAKKQEGPGP
EDTRKKGPAPTSAVSKEVPAPMTHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGL
KKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTMAEHSTKPSDAEASEGSEQEERERLRK
VLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVETPSFPCTHCGKPYRSKAGHD
YHVRSEHTAPPPEEPSDKASEAEDPLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDW
TKRRMKDDLVPETARLNYTRPGLPVLNPELLEAWKNEVKEKGHVNCPNDCCEAIYSSVSG
LKAHLASCSKGDHLVGKYCCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPRHKGVD
SPVPRKEKSPASGKKRGRKPKERPSEEPAPGTPPHQDDWPPAGRDKGARGSTGRKVGAGK
APEK
Download sequence
Identical sequences G3N139
ENSBTAP00000055562 ENSBTAP00000055562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]