SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055715 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055715
Domain Number 1 Region: 767-860
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 1055-1149
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-22
Family I set domains 0.0035
Further Details:      
 
Domain Number 3 Region: 863-957
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-21
Family I set domains 0.0049
Further Details:      
 
Domain Number 4 Region: 1151-1238
Classification Level Classification E-value
Superfamily Immunoglobulin 4.81e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 5 Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-18
Family I set domains 0.0092
Further Details:      
 
Domain Number 6 Region: 320-414
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 959-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-17
Family I set domains 0.0034
Further Details:      
 
Domain Number 8 Region: 674-764
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000192
Family I set domains 0.0066
Further Details:      
 
Domain Number 9 Region: 224-318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000241
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 413-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000386
Family I set domains 0.017
Further Details:      
 
Domain Number 11 Region: 35-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000506
Family I set domains 0.0063
Further Details:      
 
Domain Number 12 Region: 580-671
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000703
Family I set domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055715   Gene: ENSBTAG00000046476   Transcript: ENSBTAT00000064385
Sequence length 1327
Comment pep:known chromosome:UMD3.1:X:15186560:15201911:-1 gene:ENSBTAG00000046476 transcript:ENSBTAT00000064385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGEGATMLRTFTLLLFCAGLSLGVTPMVMPSQPELWIESNYPQAPWENITLWCKS
PSQISSKFLLLKDKTQMTWIRPSRKTFQVSFPIGALTQANTGLYRCCYWKETGWSEPSKV
LELEAPGQLPKPVFWIQTETSPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGR
VAIFSIANMTPESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGPIMAP
GESLNLRCQGPIYGMTFALIRLEDLEKSFYLKRPIKNEAYFFFRALKIHDAGHYLCFYYD
GSYRGSLLSDILKIWVTDTFPKTWLLAQPSPVVQMGQNVSLWCRGPVDGVGLALYKKGED
KPRQLLDTTSVYDDTSFFLNNVTSSDAGIYSCHYLLSWKTSIRTTSHNTMGLVVVAWPST
VFKLGKAITLQCRVPHPVLEFCLEWEERATSQKFSVDGDFIISNVEGKGTGTYSCSYRIE
AHPNIWSHRSEPLKLMGPAGFLTWSHILNETIRLFLIIQLVALLFVVLWIRWKCRRLRIR
EAWLLGTAQGVTMLFILTALLCCGLCTGVLTEETEIIMPTPKPELWAETNFPLAPWKNLT
LWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQTHTGSYHCHSWEEMAVS
EPSEALELVGTDILPKPVISASPPIRGKELQIRCKGWLAGMGFALYKEGMQEPIQQLGAV
GREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPFFETWTSPVV
TPGSRVTFNCSTPQQHMSFILYKDGSEVASSDSSWASLGASAAHFLIISVGIGDGGNYSC
RYYDFAIWSEPSDPVELVVTEFYPKPTLLAHPGPVVLPGKNVTLRCQGAFEGMRFALLQE
GTPGPLQFRSASGNSADFLLHTVGAEDSGNYSCVYFETTMSNRGSYLSKPLMIWVTDTFP
KPRLFAEPSSVVPVGQNVTLWCQGPVHGVGYILHKEIEATSVQLWGSTSNDGAFPITNVS
GASIGRYSCCYHPDWTSLIKIQPSNTLELIVTGLLPKPSLLAQPGPMVAPGENMTLQCQG
ELADSTFVLLKKGIQEPLKQQRPNGYRADFWMPAVSSEDSGMYSCVYYLDSAPLAASNHS
DSLEIWVTDKPPKPSLSASPSTVFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEDG
DFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDTLELVGAAGPAAQECTVGNIVRSTLIV
VVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGDLGTSTDSPSSVSQGTS
VEQPVPI
Download sequence
Identical sequences G3N1H1
ENSBTAP00000055715 ENSBTAP00000055715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]