SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056120 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056120
Domain Number 1 Region: 798-852
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 882-937
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000388
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 468-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000423
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 635-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000916
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 556-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000113
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 843-884
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000909
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 725-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000623
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 8 Region: 927-978
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000804
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056120   Gene: ENSBTAG00000021253   Transcript: ENSBTAT00000065278
Sequence length 1238
Comment pep:known_by_projection chromosome:UMD3.1:1:143569076:143621182:-1 gene:ENSBTAG00000021253 transcript:ENSBTAT00000065278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGTEGMWNQHSGKWKKNFFSNHKELSLKNANCKSKMPVAAMAEDGNEEIMFIWCEDCSQY
HDSECPELGPVVMVKDSFVLSRASSWFSWGAETHAWLGAGAVGSEYRWLGKGGVAAGRAP
RSGAGALWLCQSTFPWGWGTVSPVGSRSSLPSNLEIRRLEDGAEGVFAVTQLVKRTQFGP
FESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMMLVRPAAEPGHQNLTAFQHG
SDVYFTTSRDIPPGTELRVWYAAFYAKRMDKPMLRQACPGLQAAGTPENSTPVEAEPSQW
VCKVCSATFLELQLLNEHLLGHLEQSKSGAPAGQQESAPEKEADVPRGEPAEVPKTVSAT
KEQKKKPRRGRKPKASKPEQPLVIVEGKEPAEQVTEIMTEVEPVTVTPDERIMELVLGKL
AATPSDTSSVPKFPHHQSGTITLKRSLILSSRHGIRRKVVRQLGEHRRVYQCSICSKVFQ
NSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRNEVDSEYRYRCGTCEKTF
RIQSALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDKKFACEVCNKMFYRKDVM
LDHQRRHLEGVRRVKREDVEAGGGENLVRYRKEPSGCPVCGKVFSCRSNMNKHLLTHGDK
KYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKIGISSEENDDHSDESADS
EPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICHRRFALKATYHAHMVIHRENLP
DPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCGKSFARKDMLKEHMRVHD
NIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECRECHRKFAQKVNMLKHYKRHTGIKD
FMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSC
QLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELSLEQEEL
AEGKHVKATRRAPKRKQKPEEEAGATGPEDAAFSEFSEKEGSFSGGVGDETDSAVQSIQQ
VVVTLGDPNVTTPSSSVGLTNITVTPITTTAGTQFTNLQPVAVGHLTTPERQLQLDNSIL
TVTFDTVSGSAMLHNRQNDLQIHPQPEASNPQSVAHFINLTTLVNSITPLGSQLGEQHPL
TWRAVPQTDGPPPPPPAPAQQAAQPSVPAEQQPQMYSY
Download sequence
Identical sequences G3N2K5
ENSBTAP00000056120 ENSBTAP00000056120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]