SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056158 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056158
Domain Number 1 Region: 358-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 286-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056158   Gene: ENSBTAG00000047616   Transcript: ENSBTAT00000064414
Sequence length 417
Comment pep:known_by_projection chromosome:UMD3.1:18:55439836:55444508:1 gene:ENSBTAG00000047616 transcript:ENSBTAT00000064414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVQDSVTFEDVAVNFTWEEWALLDSAQRQLYRDVTLETCGHLACVDWATRHQTKDSTPRQ
NSLAKRTFQGVNRACLASSGSRLSDFREDWMSHRIEEPGKQRGRTLKQVAAAHEKDASPV
GFWEYPETRDISNPGQKIVPSQGDSMRKHNPRRNSDILKQILLLHSNQKISTNNEDDRVK
WQEMPWIPRARTQTELKSKARMDHQNDLLHLQAEMYMGMSICEYSPRGEALEGDISLRTG
GTPMKEKPRHSHQCENTFLNNSLPAGQTQPYEAETNNENNQSGKTFVPVPSSDSHRRTSM
GGKSYKCRECGKAFVYQSFLKKHMEIHTGEKPYTCENCGKTFRYILHLNKHLRNHNLKTF
ECPECGKSFNKSSKLKEHIRIHTGEKPYRCQECGKTFSKSSKLKEHTRIHTGEKPYK
Download sequence
Identical sequences G3N2P1
ENSBTAP00000056158 ENSBTAP00000056158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]