SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000201 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000201
Domain Number 1 Region: 543-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000397
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 576-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000836
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000201   Gene: ENSBTAG00000000176   Transcript: ENSBTAT00000000201
Sequence length 689
Comment pep:known chromosome:UMD3.1:2:22841314:22888725:1 gene:ENSBTAG00000000176 transcript:ENSBTAT00000000201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPSAATSSGQYVLPLQNLQNQQIF
SVAPGSDSSNGTVSNVQYQVIPQIQSSDGQQVQIGFTGSSDNGGINQESGQIQIIPGSNQ
TLLASGTPPANIQNLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSV
DLDSLGLSGSSQTMTAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVP
TSSSSQLPVTIDSTGILQQNTNSLTTTSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQ
PVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQNITQQALQNLQLQLNPGTFLIQA
QTVTPSGQITWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGALSSTPVS
LSTGQLPNLQTVTVNSIDSTGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTND
LTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNLGKKKQHICHIPGCGKVY
GKTSHLRAHLRWHSGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMR
SDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGTVN
TSTTSNQDILTNTEIPLQLVTVSGNETME
Download sequence
Identical sequences F1MCN2 L8HVR7 W5NQN2
ENSBTAP00000000201 ENSBTAP00000000201 9913.ENSBTAP00000000201 ENSOARP00000000472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]