SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000341 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000341
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily SNARE-like 6.41e-47
Family Synatpobrevin N-terminal domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 132-195
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.78e-17
Family SNARE fusion complex 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000341   Gene: ENSBTAG00000000274   Transcript: ENSBTAT00000000341
Sequence length 198
Comment pep:known chromosome:UMD3.1:4:77802985:77810784:-1 gene:ENSBTAG00000000274 transcript:ENSBTAT00000000341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYSLSVLYKGESKTVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSAKGSRASVK
EQEYLCHVYVRNDSLAGVVIADSEYPSRVAFTLLEKVLDEFSKQVDRIDWPTGSPDTIRY
SGLDSQLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGIQ
SKAFYKTARKQNSCCAIM
Download sequence
Identical sequences L8IE24 Q3T000
ENSBTAP00000000341 ENSBTAP00000000341 NP_001030219.1.59421 NP_001030219.1.76553 XP_005899470.1.15283 XP_019814508.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]