SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000433 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000433
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily EF-hand 1.26e-45
Family p25-alpha 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000433   Gene: ENSBTAG00000000328   Transcript: ENSBTAT00000000433
Sequence length 171
Comment pep:known chromosome:UMD3.1:10:26128308:26130477:-1 gene:ENSBTAG00000000328 transcript:ENSBTAT00000000433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEAERTFQRFAVFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAK
NARTITFQQFQEAMKELGQKRFKGKSPDEALENIYKLMEGKDPATTGVTKATTVGGVSRL
TDTSKYTGTHKERFDESGKGKGIAGREDVTDNSGYVSGYKGAGTYDKKGSN
Download sequence
Identical sequences Q3T077
NP_001029456.1.59421 NP_001029456.1.76553 XP_005900625.1.15283 ENSBTAP00000000433 ENSBTAP00000000433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]