SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000456 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000456
Domain Number 1 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 9-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 295-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 459-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000176
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 380-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000377
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 7 Region: 227-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000366
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000456   Gene: ENSBTAG00000031352   Transcript: ENSBTAT00000000456
Sequence length 511
Comment pep:known chromosome:UMD3.1:7:22110027:22121792:-1 gene:ENSBTAG00000031352 transcript:ENSBTAT00000000456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAECLLPWPQEVVTFKDVAVDFSMEEWELLDPGQRKLYRDVMLETCGNLASVEALRNQR
TNSGFEDGTICLASASQVTTFSLWTAYSLFQPVVSFHLEQGEAMWMAGKGTLRASYSDWE
TKLRSQQSVYKKVVLEEEPLGGMNITKLPREDWGYTESEGNCEDFQRLLRQMGYPQIVAF
SQEKPIDWYEFGENCNLSSELVLSRDSIGRHFYDYDLAIASLVSDPFLNHHQMGYPDQRP
CESIKCGKDLSQNIHLIPHERTQMGERISAYAESGKSFNHGMAITIQNRINTVEKPYECH
QCGKVFNRRHSLSEHQRIHTGERPFECQECGRAFTHSSTLTRHLRTHTGEKPYACHECGK
AFNRISSLTQHQRIHTGEKPYQCEDCGKSFCQSSYLILHKRTHTGEKPYECNKCGKAFSD
RSSLNQHERTHTGKNPYECNQCGRAFSQRSSLVRHERTHTGEKPYLCSECGKAFSQSSSL
ITHQKTHNSQKTYKIIDCGKAFYQSCHLVGF
Download sequence
Identical sequences A6QNX1
NP_001098507.1.59421 NP_001098507.1.76553 XP_010805312.1.76553 ENSBTAP00000000456 ENSBTAP00000000456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]