SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000497 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000497
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily POZ domain 1.69e-29
Family BTB/POZ domain 0.00078
Further Details:      
 
Domain Number 2 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 420-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000146
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 377-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000931
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000497   Gene: ENSBTAG00000000385   Transcript: ENSBTAT00000000497
Sequence length 531
Comment pep:known chromosome:UMD3.1:16:33913963:33918059:1 gene:ENSBTAG00000000385 transcript:ENSBTAT00000000497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPKGYEDSMEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHL
FYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVK
VCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDEKLNILP
SKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVR
DSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYD
MEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELEREDKASDDEMMTPESERVQVEGGM
ESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGLRSKPAADVNVPT
CSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWC
ERRFTQSGDLYRHIRKFHCELVNSLSVKSEALSLPAVRDWTLEDSSQELWK
Download sequence
Identical sequences A0A140T829 A0A212CRG4
9913.ENSBTAP00000000497 ENSBTAP00000000497 NP_001071484.1.59421 NP_001071484.1.76553 XP_005910703.1.15283 XP_005968991.1.78601 XP_006045904.1.26621 XP_010851211.1.44457 XP_017915744.1.57651 XP_019832068.1.53367 XP_019832069.1.53367 ENSBTAP00000000497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]