SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000499 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000499
Domain Number 1 Region: 407-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-18
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 131-177
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000418
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 3 Region: 347-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000096
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000000499
Domain Number - Region: 30-113
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000499   Gene: ENSBTAG00000000389   Transcript: ENSBTAT00000000499
Sequence length 474
Comment pep:known chromosome:UMD3.1:4:113127975:113131240:1 gene:ENSBTAG00000000389 transcript:ENSBTAT00000000499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQHRRKHRSSPLTSSRPPPQATEKSSYLETTEISLWTVVAAIQAMEKKVESQAARLLTLE
GRAGTAEKKLADCEKTAVELGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWIL
RLPPGSNGEVPKVSRSLENDGVCFSEQEWENLEDWQKELYANVMKSNYETLVSLKVLGQP
EGEVELGAEMPGDLEEEESRGVHPVEEVVVKQETLYTQDSSADLPGECSGFANEQALLSP
EQAELWDGQGSSILLESGPADTRLQEPTDGGRDPGSGRTLGCPPKRKCHKQLQPGRECGQ
GLQLRRDSAGPCGCPECEAPHPQTPSEPEASPRPRPQLKPPARKAQSLQCDACARSFRCR
VSLLTHQRCHLQEAARAGHPAQERFSPNSLVALPGHIPWRRSRGSLLCGYCGKSFSHPSD
LVRHQRIHTGERPYSCPECEKSFVQKQHLLQHQKIHQRERGGPALQPARPSGLL
Download sequence
Identical sequences F1ME16
ENSBTAP00000000499 ENSBTAP00000000499 9913.ENSBTAP00000000499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]