SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000598 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000598
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 216-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000598   Gene: ENSBTAG00000000472   Transcript: ENSBTAT00000000598
Sequence length 536
Comment pep:known chromosome:UMD3.1:18:47656764:47675770:1 gene:ENSBTAG00000000472 transcript:ENSBTAT00000000598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGLLKAMYQELVTFRDVAVDFSQEEWDYLNPSQRHLYSNVMLENYRILVSLGLCFSKP
SVILLLEQGKEPWMAKREMTKDLCSDWESMCETEELTPKQDIYEPQSSQKVIEKLTSYGL
EYSSLKEEWKCEGHLEGQPMNQKACFKEETITHEEAPVNERGQEYNKTWRSFHPNTLLHT
QQIIPKEEKVHKHNTHKSLKKKLIAIKPKSIYTEKKLLKCNDCEKVFSQSSSLTLHQRIH
TGEKPYKCVECGKAFSQRSNLVQHQRIHTGEKPYECKECRKAFSQNAHLVQHLRVHTGEK
PYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYEC
NVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQQCR
KAFSQIAYLAQHQRVHTGEKPYECIKCGKAFSNDSSLTQHQRVHTGEKPYECNVCGKAFS
YCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHLGESLSPPNPVSHQVL
Download sequence
Identical sequences F1N7K0
ENSBTAP00000000598 NP_001178282.1.59421 NP_001178282.1.76553 XP_005218953.1.76553 ENSBTAP00000000598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]