SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000628 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000628
Domain Number 1 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000153
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000628   Gene: ENSBTAG00000040031   Transcript: ENSBTAT00000000628
Sequence length 794
Comment pep:known chromosome:UMD3.1:1:70287257:70382437:-1 gene:ENSBTAG00000040031 transcript:ENSBTAT00000000628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSTVSGELQESVLQDRSMPHQEILAA
DEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITF
TDVSEQLMRDKKQIREPVDLQKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAF
RTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKY
HMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEED
SGFSTSPKDNSLPKKKRQKTEKKSSGMDKESSLDKSDLKKDKNDYLPLYSSSTKVKDEYM
VAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES
KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAA
SNNSREYALNVGTIASQPSVTQAAVASVIDESTTASILDSQALNVEIKSNHDKNVIPDEV
LQTLLDHYSHKANGQHEISFSVADTEVTSSISINSSEVPEVTQSENVGSSSQASSSDKAN
MLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYAAMPINSFR
SGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPV
HQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFPEFPLVNVNDNRAG
MTSSPDATTGQTFG
Download sequence
Identical sequences F1MS30 L8I3X5
ENSTTRP00000013953 9913.ENSBTAP00000000628 ENSBTAP00000000628 ENSBTAP00000000628 ENSTTRP00000013953 XP_004278859.1.21590 XP_004278860.1.21590 XP_005201473.1.76553 XP_005201474.1.76553 XP_005201475.1.76553 XP_005201476.1.76553 XP_005201479.1.76553 XP_005201480.1.76553 XP_005904549.1.15283 XP_006078584.1.26621 XP_006078585.1.26621 XP_006078586.1.26621 XP_006078587.1.26621 XP_006078588.1.26621 XP_010799488.1.76553 XP_010799489.1.76553 XP_010832585.1.44457 XP_010832586.1.44457 XP_010832587.1.44457 XP_010832588.1.44457 XP_010832589.1.44457 XP_010832590.1.44457 XP_019778201.1.83887 XP_019778202.1.83887 XP_019778203.1.83887 XP_019778204.1.83887 XP_019778205.1.83887 XP_019778206.1.83887 XP_019812477.1.53367 XP_019812485.1.53367 XP_019812495.1.53367 XP_019812502.1.53367 XP_019812512.1.53367 XP_019812518.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]