SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000920 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000920
Domain Number 1 Region: 277-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000123
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 3 Region: 241-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000011
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000920   Gene: ENSBTAG00000000688   Transcript: ENSBTAT00000000920
Sequence length 375
Comment pep:known chromosome:UMD3.1:18:63800040:63802821:-1 gene:ENSBTAG00000000688 transcript:ENSBTAT00000000920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRYKQKPKNWTIVCIQGQKYLVHDPDIEMVEAKAGDMDDERVPCEEPQLPSRVIPPEDG
QDRSQELQNLPGATNLSREQDERALPPETVPETGELEGQTPRENLEKDLLEDRGETKTLQ
SQEPELLMGPGEYSKPWNSADSGHIERQKNPQEETVSSCVPEGDVSTTRGSRRGPLKNRR
HVKRKWDSSLTCQDVRQEAATCLDQEEFSGQLGSHSIDASGTVGPTSLPEGAETPGRAPS
EFRVCKKSFPYQSQLTLLQRTNTGERPFQCDICAKGFIQLSELRVHEQIHTGEKPYCDLC
LKKFTQDSTLNAHKRTHTQEKPFHCEHCDRAFSHRGNLNVHRRIHSGLKPYVCPECHGAF
RHLGTFKRHQKIHSK
Download sequence
Identical sequences G5E504
ENSBTAP00000000920 ENSBTAP00000000920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]