SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000946 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000946
Domain Number 1 Region: 44-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 108-178
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000811
Family VWC domain 0.074
Further Details:      
 
Domain Number 3 Region: 207-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000946   Gene: ENSBTAG00000000707   Transcript: ENSBTAT00000000946
Sequence length 360
Comment pep:known chromosome:UMD3.1:14:9176079:9187850:-1 gene:ENSBTAG00000000707 transcript:ENSBTAT00000000946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGWPNPGLLYIFSPPQALPPAPTAMGPTPAPLEDTSSRPQFCKWPCECPAAPPRCPLGVS
LITDGCECCKMCAQQLGDNCTEAAVCDPHRGLYCDYSGDHPRYAVGVCAQVVGVGCVLDG
VRYNNGQSFQPNCKYNCTCVGGAVGCTPLCLRARPPRLWCRRPQRVSLPGRCCEQWVCED
DARRPRKTAPRHTGTSGNMDEIEPWHKNCIAYTSPWSPCSTSCGLGVSTRISNVNTRCWP
EQESRLCNLRPCDVDLRPHIKEGKKCLAVYQPEAPVNFTLAGCTSTRTYRPKYCGVCTDS
RCCIPYKSKTISISFQCPDGPGFSRQALWINACFCNLSCRNPNDIFADLDSYPDFSEIAN
Download sequence
Identical sequences F1MS46
ENSBTAP00000000946 ENSBTAP00000000946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]