SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000971 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000971
Domain Number 1 Region: 163-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 332-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000375
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 3 Region: 205-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000128
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 10-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000615
Family KRAB domain (Kruppel-associated box) 0.0076
Further Details:      
 
Domain Number 5 Region: 370-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000779
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000971   Gene: ENSBTAG00000000728   Transcript: ENSBTAT00000000971
Sequence length 417
Comment pep:known chromosome:UMD3.1:25:2851384:2855519:-1 gene:ENSBTAG00000000728 transcript:ENSBTAT00000000971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTHPTAEAHGPVLFEDLAVYFSQEECASLHPAQRSLSGEVTQECFEDKALSENDKIEI
NQLLHLESMGLEELALEKCSLAVPLIYYQEKCSEHGAGNFERKISGGISACKKRFRSLLV
TIENHTPKIELAQSLRTRALPKILPFPKEETKKSYKCPECDQSFSGSSYLVWHQKTHVGK
KKCECDDCGKIFNHRSNLRAHRRIHTGEKPYKCFLPVWSAAQCGSSFHQPSHLSQHRKTH
LKEKIHRCGICGRGLTQLRGLSQHQKTHTATKAGDKYVSQKTNLALPEEKHRCAAPAGNA
LGSPCIPAQERPQDNLNTTAIEEILLSFSKFKPLKCSTCSKTFLSASELISHQNIHRGEK
PHKPKTCTESFILDSELTCHQKSHVREEPFKYTRCGRNFRLKTHLTLDQQTHSQNTV
Download sequence
Identical sequences E1B9U1
ENSBTAP00000000971 ENSBTAP00000000971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]