SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001004 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001004
Domain Number 1 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000128
Family HkH motif-containing C2H2 finger 0.06
Further Details:      
 
Domain Number 2 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000061
Family HkH motif-containing C2H2 finger 0.056
Further Details:      
 
Domain Number 3 Region: 286-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000782
Family Classic zinc finger, C2H2 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001004   Gene: ENSBTAG00000000755   Transcript: ENSBTAT00000001004
Sequence length 970
Comment pep:known chromosome:UMD3.1:7:21381365:21404904:1 gene:ENSBTAG00000000755 transcript:ENSBTAT00000001004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFPEAAPPPGPGYSGYQPHSGQDLGYSTQPQEPTPAATTAPSYQDSYSYGLSTATSGYES
KQYPPPAAGHQLPATATLCPPGGSGGYACSPGTQGAYGGGGYGQAQPLPQMPTAEAGPPA
SVACSSYTYAPTSSAQPMASSIPTLPASSSFSAASAPYTGPSYPSYDASSYSVAGPYYPP
LLTPQMQPPPPPPPPPKPVDSSQWGGPVGSPSASCTNSVAKKLPVPSKLPRPRTGPQPLP
LHYCDICKISCAGPQQTYREHLEGQKHKKKEAAQKMGVQPNGSPRGVQAQLRCDLCAVSC
TGAEAYAAHIRGAKHQKVFKLHTKLGKPIPTIDPAPADPGLAQAPSTSQPASIPVTVTAE
SAPAASAKPAAPASPSVCAPSRPPPPRRPATSKASRVGTALRLTATPGFRPGGASWCLWS
TWGRPPALPATDCRAPHGKPATPRSERPGEPSARGGSTEASGSSCEGQPVGPGYVEEVCN
EEGRVIRFHCKLCECSFNDPNARDMHVRGRRHRLQYKKKVNPDLPIADKPSTRVRKLVEE
TLRRQRQLTKRRLGELRRWHNETRRYDLCRRRLEEGPPVPDAHSGRPLPDQHLPALRSRP
GAPTAKPLPTRRPESSDDRHVMCKHAAIYPTEEELLAVQKAVSHAERALKLVSDTLAEED
SASPEPEGGDHSSRPSPSARILKGVMRVGLLAKGLLLRGDRAVQLILLCSQKPTRALQRR
VAEQLPLQLPVVTDDKYEVSSDPDASIVISSCEEPRIQVAVSITSPLMREDPSADQEGTE
VPLPDPGDVLSPEKCLQALAALRHAKWFQARASGLQPCVIVIRVFRDLCQRVPTWGALPD
WAMELLVEKALSSTKGPLSPGDAVRRVLECVASGTLLTDGPGLQDPCERDQMDALGSMTL
QEREDITASAQHALRMLAFRQIHKILGIDPLPPPRIRLGARFRKRPREASELEAKVGSNQ
RKRPRLPNGT
Download sequence
Identical sequences F1MWK5
ENSBTAP00000001004 9913.ENSBTAP00000001004 ENSBTAP00000001004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]