SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001064 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001064
Domain Number 1 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 549-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 413-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 329-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 128-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000995
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 261-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000143
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 230-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000064
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 382-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000199
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001064   Gene: ENSBTAG00000000803   Transcript: ENSBTAT00000001064
Sequence length 610
Comment pep:known chromosome:UMD3.1:18:63871806:63894090:1 gene:ENSBTAG00000000803 transcript:ENSBTAT00000001064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAARGKSKSKAPVTFGDLAIYFSQEEWEWLSPIQKDLYEDVMLENYQNLVSLGLSFRRP
NVITLLEKGKAPWMVDPVKRRRGLDLGSKCETKKLPPNQCNKSGQSIYQKPVSTPQKVPT
GKRGCRKNSVLIKRKKVHSEKKSLKCNDCGKFFSQSLSLKFHQNSHAGEKPYECSSCRKA
FRQISSLILHQKIHNGRKSFECNKCGESFIQRTSLLLHGKIHGEKEVFDCGKALSQCSSL
SIHQKIHFVENVYQCRKCKKAFIRMSSFLLHKKIHSGKKIHKCNKCRRVFSKKSVLVIHK
RIHTGEKTCESEKALSHSLQQRSHHLENPYKCRKCGKFFSRISSIMLHQRIHNSEKPHKC
NKCEKIFRRLSTLILHLRIHNKEKLYQCNKCAKVCNRHSSLIQHQKVHTKKKKLFECKEC
GKMFSGTANLKIHQNIHSEEKPFKCNKCSKVFGRQSFLIEHQRIHTGEKPYQCEECGKAF
SHRISLTRHKRIHSEDRPYECDQCGKAFSQSAHLAQHERIHTGEKPYTCKTCGKAFSQRT
SLILHERSHTGEKPYECNECGKAFSSGSDLIRHQRSHSSEKPYECSKCGKAYSRSSSLIR
HQNTHSEEKA
Download sequence
Identical sequences A6QNL4 L8HNW3
9913.ENSBTAP00000001064 ENSBTAP00000001064 NP_001095548.1.59421 NP_001095548.1.76553 XP_005219841.1.76553 XP_005219842.1.76553 XP_005911422.1.15283 XP_010813871.1.76553 ENSBTAP00000001064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]