SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001081 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001081
Domain Number 1 Region: 616-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 579-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000104
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 657-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000688
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 100-204
Classification Level Classification E-value
Superfamily SET domain 0.000000000101
Family Histone lysine methyltransferases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001081   Gene: ENSBTAG00000000816   Transcript: ENSBTAT00000001081
Sequence length 828
Comment pep:known chromosome:UMD3.1:9:44355220:44377512:-1 gene:ENSBTAG00000000816 transcript:ENSBTAT00000001081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDICLEKRVGTTLAAPKCSSSAVKVPGLAEGTEGTMKMDMEDADMTLWTEAEFEEKCTY
IVNDHPWDSGVEGGTSVQAEASLPRNLLFKYATNSKEITGVVSKEYIPKGTRFGPLIGEI
YTSDAVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWLRYVNPAHTAREQNLAACQNGM
NIYFYTIKPIPANQELLVWYCRDFAERLHYPYSGELTMMNLTQTQSRPKQQSTEKHELCP
KSVPKREYSVKEILKLDSHPSKGKDLYRSNISPLTSEKDAEDFRKNGSPEMPFYPRVVYP
IRAPLPEDFLKAPLGCYGMERPPYITHSPISSSTTPSPSARSSPDRSLQSCSPHSSPGNT
VSPRAPGPQEARDSYAYLNAPYGAAAEGLGSLAGYGPPTHLPPAFIPSYNAHYPKFLLPP
YGMNCNGLGAAVSNINGLNSFGLFPRLYPVYSSLLGGGGLPPPVLASASLPSSLPSEGAR
RLLQPEHPREVLVPAPHSAFSLPGAAASLKDKACTPTSGSPTAGTAATAEHVVQPKATSA
AAAAPGGEEAVNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRV
HSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGE
KPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAHCHKSYIHFCSLKVHLKGHCPVAPAT
GLPLEDLARINEEIEKFDISDNADRLEDMEDNIDMTSVVENEILAVVRKEKEETGLKASL
QRNLGNGLLSGYNLYESTEPSLLKLPHSNPLPLGPVKVKEETVEPMDP
Download sequence
Identical sequences E1BJ30
ENSBTAP00000001081 NP_001179865.1.59421 NP_001179865.1.76553 9913.ENSBTAP00000001081 ENSBTAP00000001081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]