SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001094 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001094
Domain Number 1 Region: 7-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.67e-100
Family Calpain large subunit, catalytic domain (domain II) 0.000000285
Further Details:      
 
Domain Number 2 Region: 356-497
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 8.5e-33
Family Calpain large subunit, middle domain (domain III) 0.00036
Further Details:      
 
Domain Number 3 Region: 519-632
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.78e-16
Family Synaptotagmin-like (S variant) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001094   Gene: ENSBTAG00000000828   Transcript: ENSBTAT00000001094
Sequence length 641
Comment pep:known chromosome:UMD3.1:X:64684214:64708869:-1 gene:ENSBTAG00000000828 transcript:ENSBTAT00000001094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPLKFFKNQKYQELKQECIRDGRLFCDPTFLPENDSLFYNRLLPGKVIWKRPQDICDD
PRLIVGNISNHQLTQGRLGHKPMVSAFSCLAVQECHWTKTIPNYKEQEWDPRKIDKYAGI
FHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGL
TTSDIIVDFTGTLAETVDMQKGRYTDLVEEKYKLFKELYKTFTKGGLICCSIEFPDQEEQ
EVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSTEKLYMIRLRNPLGRQEWSGPWSEISE
EWQQLTAADRKNLGIVMSDDGEFWMSLEDFCRNFHELNVCRNVNNPLFGHKELESVVGCW
TVNDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDEHKVIMSLQQKDLRTYRRMGRPDNYI
IGFELFKVELNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTS
EFLLRIFCEVPVQLRELTMDMPKMSCWNLARGYPKVVTQITVHSAEGLEKKYDNETVNPY
LIIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNKRKFCDQFLGQVILDA
DPSDCRELKSLYLRKKGGPTAKVKQGHISFKIISSDDLTEL
Download sequence
Identical sequences E1BJ18 L8I5P9
ENSBTAP00000001094 9913.ENSBTAP00000001094 NP_001179160.1.59421 NP_001179160.1.76553 XP_005903725.1.15283 XP_019811568.1.53367 ENSBTAP00000001094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]