SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001155 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001155
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 12-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 168-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000011
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001155   Gene: ENSBTAG00000000868   Transcript: ENSBTAT00000001155
Sequence length 415
Comment pep:known chromosome:UMD3.1:18:2532232:2536014:1 gene:ENSBTAG00000000868 transcript:ENSBTAT00000001155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNANHIRINSNMPFQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVW
KADDQMETDPRNPDEQARPFVIFKDQTPTEERDNNLFGKTFNLSTDFVSLRQVPYKYDLY
EKTLRYNSDLLTSNRNYIRKKADDCNGFGKALFYLKQEKTHPGVEYSEYNKSGKAFSHKE
AIFKHQKIRNLVQPFICNYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIK
HQRIHTGEKPFECLECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRI
HTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGE
KPYECTECGKTFSQRSTLRLHLRIHTGEKPYECAECGKAFSRKSRLSVHQRVHTG
Download sequence
Identical sequences F1MTX5
ENSBTAP00000001155 ENSBTAP00000001155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]