SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001247 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001247
Domain Number 1 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.31e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 252-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 39-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-18
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 7 Region: 214-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000666
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001247   Gene: ENSBTAG00000000943   Transcript: ENSBTAT00000001247
Sequence length 521
Comment pep:known chromosome:UMD3.1:19:33673396:33688126:1 gene:ENSBTAG00000000943 transcript:ENSBTAT00000001247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDVAETPGKRALPPQDSPFSQENCTEEGEVAALRLTARSQASVTFKDVAMDFTPEEWG
RLDPTQRDVMLENYRNLVSLWLPVSKPENHSLENGKEPLLLERKAPKSSCSDSETSPRSK
HSTSVQDFSKEESCQVAVIDRLTRDSVCDSSTETTLDCEDWLENQQGSQERHWRGMFTHM
NSLPEERAPEHDVYWKTLGQKSVLLTQDRVPKGPYAFHTLEKRLKQKSTLMKKQRTYKEK
KPHKCNDCGELFTYHSVLIRHQRVHTGEKPYSCADCGKSFSHRANLTKHQRTHTRILFEC
SECKKAFTESASLAIHQRIHIGERPYECGECGKGFNRSTHLVQHQLIHTGVKPYECNECD
KAFIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFS
QSTHLVQHQRIHTGEKPYECHECGKTFSRSSNFAKHQRIHIGKKPYKCNECSKAFIHSSA
LIQHQRTHTGEKPYRCNECGKSFKCSSSLIRHQRIHMEEQP
Download sequence
Identical sequences F1MTK8
ENSBTAP00000001247 XP_010814357.1.76553 ENSBTAP00000001247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]