SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001332 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001332
Domain Number 1 Region: 384-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000874
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001332   Gene: ENSBTAG00000001005   Transcript: ENSBTAT00000001332
Sequence length 545
Comment pep:known chromosome:UMD3.1:17:73002288:73010751:-1 gene:ENSBTAG00000001005 transcript:ENSBTAT00000001332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPCMLCEEDQEPEPQKSVGETKQVDDEDAELIFVGVEHVNEDADLIFVGMTSNSKPVV
SNILNRVTPGSCSRRKRYGHFRKDNAHKLQPVSHVTRTSEAKIVLPVSDSESRSTDSPII
IEPLSKPDYKNISPQIVPNSFSELCSPLITFTSSLQHPVETTVSAGDMNKSPRVSKRLST
SETNSTNPKRPKLSDGIIGEHSLALSPSGIFQQNFLTTQQSKPDSVHTSLSHVQNGEPCP
TAFAKDNVHCKPVSPLGENGLTKSDFPSLASQKKIVDPTEGNLIVLLRDFYYGQHIGDGQ
PEPKTHTAFKCLSCLKVLKNLKFMNHMKHHLELERQRGDSWKNHTTCQHCHRQFPTPFQL
QCHIESVHTSQEPSTVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVCSYRSSVFADV
DAHFRAYHGNTKNLLCPFCLKIFKTATPYMCHYRGHWEKSFHQCSKCRLQFLTFKEKMEH
KTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNISDSEPSPPKSKSRS
SKKPC
Download sequence
Identical sequences F1MJT5
ENSBTAP00000001332 ENSBTAP00000001332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]